missing translation for 'onlineSavingsMsg'
Learn More

SFMBT1 Antibody, Novus Biologicals™

Product Code. 18649626 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
Product Code. Quantity unitSize
18649626 0.1 mL 0.1mL
18669957 25 μL 25µL
2 options
This item is not returnable. View return policy

Product Code. 18649626

Brand: Novus Biologicals NBP248652

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SFMBT1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51460
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.