missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500300

SF2 Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™

Product Code. 30500300 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500300 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500300 Supplier Novus Biologicals Supplier No. NBP335675JF669

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SF2 Polyclonal antibody specifically detects SF2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SF2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Janelia Fluor 669
Formulation 50mM Sodium Borate
Gene Alias Alternative-splicing factor 1, ASFpre-mRNA-splicing factor SF2, P33 subunit, MGC5228, serine/arginine-rich splicing factor 1, SF2FLJ53078, SF2p33, SFRS1splicing factor 2, Splicing factor, arginine/serine-rich 1ASF-1, SR splicing factor 1, SRp30a
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-248 of human SF2 (NP_008855.1).,, Sequence:, GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 6426
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.