missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SEMA3B (Human) Recombinant Protein

Human SEMA3B full-length ORF (BAC03823.1, 1 a.a. - 132 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00007869-P01.10ug

Additional Details : Weight : 0.00010kg


 View more versions of this product

Product Code. 16142172

  • 4130.00 NOK / 10µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV
Specifications

Specifications

BAC03823.1
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SEMA3B
GST
7869
Wheat germ expression system
10 μg
FLJ34863, LUCA-1, SEMA5, SEMAA, SemA, semaV
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Safety and Handling

Safety and Handling

Product Identifier
  • SEMA3B (Human) Recombinant Protein (P01)

Signal Word
  • Warning

Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2

Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.

Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash hands thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P304+P340-IF INHALED: Remove person to fresh air and keep comfortable for breathing.
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information
  • MIXTURE LIST-Contains : tris-HCl, reduced glutathione

SDS
Documents
Certificates
Special Offers

Special Offers