missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SDHC Polyclonal antibody specifically detects SDHC in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | SDHC |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | FITC |
| Formulation | PBS |
| Gene Alias | Integral membrane protein CII-3, mitochondrial, PGL3, QPs1, QPs-1, SDH3, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa, succinate-ubiquinone oxidoreducatase cytochrome B large subunit |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1).,, Sequence:, MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?