Abnova™ SAA4 Recombinant Protein

Name: Abnova&trade; SAA4 Recombinant Protein
Brand: Abnova&trade;
SKU: 16130512
Price: 4115.00 EUR

Marque: Abnova™ H00006291-P01.10ug

Informations supplémentaires : Weight : 0.00010kg

Code produit. 16130512

Estimated Shipment: 27-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Accession Number	AAH07026
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	40.04
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Gene Alias	C-SAA/CSAA
Gene Symbol	SAA4
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	6291
Name	SAA4 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SAA4
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Suggestions de produits

Description