missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RTN1 Recombinant Protein

Brand:  Abnova™ H00006252-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16190402

  • 4115.00 NOK / 10µg
Estimated Shipment: 24-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH00314.2
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
48.62
8
Glutathione Sepharose 4 Fast Flow
10 ug
MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
MGC133250/NSP
RTN1
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
6252
RTN1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RTN1
Human
Recombinant
Solution
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers