missing translation for 'onlineSavingsMsg'
Learn More

RPLP2 Antibody, Novus Biologicals™

Product Code. 18195014 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
Product Code. Quantity unitSize
18195014 0.1 mL 0.1mL
18476671 25 μL 25µL
2 options
This item is not returnable. View return policy

Product Code. 18195014

Brand: Novus Biologicals NBP233688

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RPLP2 Polyclonal specifically detects RPLP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RPLP2
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P05387
Gene Alias acidic ribosomal phosphoprotein P2, MGC71408,60S acidic ribosomal protein P2, P2, Renal carcinoma antigen NY-REN-44, ribosomal protein, large, P2, RPP2D11S2243E
Gene Symbols RPLP2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6181
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.