missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
RPL5 Polyclonal antibody specifically detects RPL5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antigen | RPL5 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 525 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DBA6,60S ribosomal protein L5, MGC117339, ribosomal protein L5 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2).,, Sequence:, MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?