missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13132-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15952599

  • 1155.00 NOK / 1mg
Estimated Shipment: 01-02-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Pramlintide Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Videos
SDS
Documents
Certificates
Special Offers

Special Offers