missing translation for 'onlineSavingsMsg'
Learn More

DNAH7, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DNAH7.

Brand: Abnova PAB22820.100uL

Product Code. 16175460

8475.00 NOK
5954.37 NOK / 100µL
Save 2520.63 NOK
29% Off

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DNAH7 is a component of the inner dynein arm of ciliary axonemes (Zhang et al., 2002 [PubMed 11877439]).[supplied by OMIM

Sequence: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY

Specifications

Antigen	DNAH7
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant DNAH7.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.	Q8WXX0
Gene Symbols	DNAH7
Immunogen	Recombinant protein corresponding to amino acids of human DNAH7.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Applications	Immunohistochemistry (PFA fixed)
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Gene	DNAH7
Gene Alias	DKFZp686C09101/FLJ37196/KIAA0944/MGC39580
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	56171
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

DNAH7, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions