missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB31 Recombinant Protein

Brand:  Abnova™ H00011031-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123556

  • 6245.00 NOK / 25µg

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH01148.1
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
47.08
8
Glutathione Sepharose 4 Fast Flow
25 ug
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Rab22B
RAB31
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
11031
RAB31 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAB31
Human
Recombinant
Solution
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers