Learn More
Abnova™ PYCARD Recombinant Protein
Human PYCARD full-length ORF ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00029108-P01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
- Molecular weight: 42.13kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
- Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
Best use within three months from the date of receipt of this protein
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH13569.2 | |
Solution | |
29108 | |
PYCARD (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PYCARD | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
42.13 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS | |
ASC/CARD5/MGC10332/TMS/TMS-1/TMS1 | |
PYCARD | |
Wheat Germ (in vitro) | |
GST |