missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPP6C (Human) Recombinant Protein

Human PPP6C full-length ORF ( AAH06990, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005537-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139491

  • 5420.23 NOK / 25µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Specifications

Specifications

AAH06990
protein phosphatase 6, catalytic subunit
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PPP6C
GST
5537
Wheat germ expression system
25 μg
FLJ92648, MGC12249
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates