missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PPM1D (Human) Recombinant Protein
Human PPM1D partial ORF ( NP_003611, 496 a.a. - 605 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00008493-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC
Specifications
| NP_003611 | |
| protein phosphatase 1D magnesium-dependent, delta isoform | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PPM1D | |
| GST |
| 8493 | |
| Wheat germ expression system | |
| 10 μg | |
| PP2C-DELTA, WIP1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |