missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPM1B (Human) Recombinant Protein

Name: Abnova&trade; PPM1B (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16139411
Price: 4115.00 EUR

Human PPM1B full-length ORF ( AAH12002, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005495-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16139411

Estimated Shipment: 24-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Specifications

Accession Number	AAH12002
Name	protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PPM1B
Protein Tag	GST

Gene ID (Entrez)	5495
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	MGC21657, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description