missing translation for 'onlineSavingsMsg'
Learn More

PKC beta Antibody [DyLight 594], Novus Biologicals Biologicals™

Product Code. 30498611 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498611 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498611 Supplier Novus Biologicals Supplier No. NBP335369DL594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PKC beta Polyclonal antibody specifically detects PKC beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKC beta
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 594
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human PKC beta (NP_997700.1).,, Sequence:, SFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5579
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.