missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PCNA associated factor Polyclonal antibody specifically detects PCNA associated factor in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | PCNA associated factor |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, KIAA0101, NS5ATP9p15PAF, OEATC-1OEATC1, Overexpressed in anaplastic thyroid carcinoma 1, p15(PAF), PAF, PCNA-associated factor |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human PCNA associated factor (NP_055551.1).,, Sequence:, SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?