missing translation for 'onlineSavingsMsg'
Learn More

P4HA2 Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™

Product Code. 30499690 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499690 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499690 Supplier Novus Biologicals Supplier No. NBP338083CL1

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

P4HA2 Polyclonal antibody specifically detects P4HA2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen P4HA2
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate CoraFluor 1
Formulation PBS
Gene Alias 2-oxoglutarate-4-dioxygenase subunit alpha-2, 4-PH alpha 2, 4-PH alpha-2, alpha polypeptide II, collagen prolyl 4-hydroxylase alpha(II), C-P4Halpha(II), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-2, prolyl 4-hydroxylase, alpha polypeptide II
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1).,, Sequence:, SHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8974
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark. Do not freeze.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.