missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ODF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17139-25UL
This item is not returnable.
View return policy
Description
ODF4 Polyclonal antibody specifically detects ODF4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ODF4 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| cancer/testis antigen 134, cancer/testis antigen 136, CT134, CT136, hOPPO1, MGC138215, OPPO1MGC138219, outer dense fiber 4, outer dense fiber of sperm tails 4, Outer dense fiber of sperm tails protein 4, outer dense fiber protein 4, Testis-specific protein oppo 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 146852 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction