missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OBCAM/OPCML Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09427-100UL
This item is not returnable.
View return policy
Description
OBCAM/OPCML Polyclonal specifically detects OBCAM/OPCML in Rat samples. It is validated for Western Blot.
Specifications
| OBCAM/OPCML | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| IgLON family member 1, IGLON1opioid-binding protein/cell adhesion molecule-like, OBCAMopiate binding-cell adhesion molecule, OPCM, opioid binding protein/cell adhesion molecule-like, opioid binding protein/cell adhesion molecule-like preprotein, Opioid-binding cell adhesion molecule, opioid-binding protein/cell adhesion molecule | |
| The immunogen for Anti-OBCAM/OPCML antibody is: synthetic peptide directed towards the C-terminal of Rat OPCM (NP_446300.1). Peptide sequence EDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNT | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4978 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction