missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NXT2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
1895.00 NOK - 4350.00 NOK
Specifications
| Antigen | NXT2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600701
|
Novus Biologicals
NBP2-93010-0.02ml |
0.02 mL |
1895.00 NOK
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659840
|
Novus Biologicals
NBP2-93010-0.1ml |
0.1 mL |
4350.00 NOK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NXT2 Polyclonal antibody specifically detects NXT2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| NXT2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 55916 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| BM-025, NTF2-related export protein 2, nuclear transport factor 2-like export factor 2, protein p15-2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2). GLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title