missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498277

NUCKS1 Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30498277 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498277 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498277 Supplier Novus Biologicals Supplier No. NBP337908H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NUCKS1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).,, Sequence:, ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64710
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.