missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NPHS1 (Human) Recombinant Protein

Human NPHS1 partial ORF ( NP_004637.1, 33 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004868-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142045

  • 4130.00 NOK / 10µg
Estimated Shipment: 26-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Specifications

Specifications

NP_004637.1
nephrosis 1, congenital, Finnish type (nephrin)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NPHS1
GST
4868
Wheat germ expression system
10 μg
CNF, NPHN
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers