missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NME1 (Human) Recombinant Protein

Human NME1 full-length ORF ( AAH00293, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004830-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16128401

  • 4115.00 NOK / 10µg
Estimated Shipment: 13-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Specifications

Specifications

AAH00293
non-metastatic cells 1, protein (NM23A) expressed in
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NME1
GST
4830
Wheat germ expression system
10 μg
AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers