missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499725

NDUFS6 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30499725 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30499725 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30499725

Brand: Novus Biologicals NBP338065AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFS6 Polyclonal antibody specifically detects NDUFS6 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFS6
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias CI13KDA, Complex I-13kD-A, mitochondrial respiratory chain, 13-kD subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).,, Sequence:, GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 4726
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.