missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500556

NDUFAB1 Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™

Product Code. 30500556 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30500556 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30500556

Brand: Novus Biologicals NBP335453MFV500

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFAB1 Polyclonal antibody specifically detects NDUFAB1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFAB1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 500 SE
Formulation 50mM Sodium Borate
Gene Alias ACPMGC65095, acyl carrier protein, mitochondrial, CI-SDAP, complex I SDAP subunit, FASN2A, mitochondrial acyl carrier protein, NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP), NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa, NADH:ubiquinone oxidoreductase SDAP subunit, NADH-ubiquinone oxidoreductase 9.6 kDa subunit, SDAP
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1).,, Sequence:, PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4706
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.