missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500169

NDUFAB1 Antibody [FITC], Novus Biologicals Biologicals™

Product Code. 30500169 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500169 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500169 Supplier Novus Biologicals Supplier No. NBP335453F

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFAB1 Polyclonal antibody specifically detects NDUFAB1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFAB1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate FITC
Formulation PBS
Gene Alias ACPMGC65095, acyl carrier protein, mitochondrial, CI-SDAP, complex I SDAP subunit, FASN2A, mitochondrial acyl carrier protein, NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP), NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa, NADH:ubiquinone oxidoreductase SDAP subunit, NADH-ubiquinone oxidoreductase 9.6 kDa subunit, SDAP
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1).,, Sequence:, PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4706
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.