missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499801

Myelin PLP Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™

Product Code. 30499801 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499801 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499801 Supplier Novus Biologicals Supplier No. NBP335912JF646

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Myelin PLP Polyclonal antibody specifically detects Myelin PLP in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Myelin PLP
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Janelia Fluor 646
Formulation 50mM Sodium Borate
Gene Alias HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human Myelin PLP (NP_000524.3).,, Sequence:, GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5354
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.