missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MT1F (Human) Recombinant Protein
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Description
- Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
Specifications
Specifications
| Accession Number | AAH29453 |
| Gene ID (Entrez) | 4494 |
| Name | metallothionein 1F |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Quantity | 10 μg |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Alias | MGC32732, MT1 |
| Gene Symbol | MT1F |
| Species | Wheat Germ (in vitro) |
| Show More |
Safety and Handling
Product Identifier
- MT1F (Human) Recombinant Protein (P01)
- Warning
- Acute toxicity Category 4
- Serious eye damage/eye irritation Category 2
- Skin corrosion/irritation Category 2
- H302-Harmful if swallowed.
- H315-Causes skin irritation.
- H319-Causes serious eye irritation.
- P102-Keep out of reach of children.
- P103-Read label before use.
- P233-Keep container tightly closed.
- P264-Wash thoroughly after handling.
- P270-Do not eat, drink or smoke when using this product.
- P280-Wear protective gloves/protective clothing/eye protection/face protection.
- P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
- P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P404-Store in a closed container.
- P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
- MIXTURE LIST-Contains : Tris-HCl, Reduced glutathione
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction