missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500581

MST3 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Product Code. 30500581 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500581 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500581 Supplier Novus Biologicals Supplier No. NBP335153JF525

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MST3 Polyclonal antibody specifically detects MST3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MST3
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Janelia Fluor 525
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 3, MST-3, MST3serine/threonine kinase 24 (Ste20, yeast homolog), serine/threonine kinase 24, serine/threonine-protein kinase 24, STE20, STE20-like kinase 3, STE20-like kinase MST3, sterile 20-like kinase 3, STK3yeast)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 312-431 of human MST3 (NP_001027467.2).,, Sequence:, TDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 8428
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.