missing translation for 'onlineSavingsMsg'
Learn More

MS4A8B Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30498242 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498242 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498242 Supplier Novus Biologicals Supplier No. NBP335124APC

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MS4A8B Polyclonal antibody specifically detects MS4A8B in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MS4A8B
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate APC
Formulation PBS
Gene Alias 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1).,, Sequence:, SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83661
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.