missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MRPS17 Recombinant Protein

Product Code. p-3720276
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Product Code. Quantity unitSize
16119962 10 μg 10µg
16129962 25 μg 25µg
2 options
This item is not returnable. View return policy

Product Code. 16119962

Brand: Abnova™ H00051373P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH54031
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 51373
Molecular Weight (g/mol) 40.04
Name MRPS17 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias HSPC011/MRP-S17/RPMS17
Common Name MRPS17
Gene Symbol MRPS17
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.