missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MRPS17 Recombinant Protein

Produktkod. 16119962
missing translation for 'orderingAttributeHoverText'
Quantity:
10 μg
25 μg
Förpackningsstorlek
10µg
25µg
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 16119962

missing translation for 'mfr': Abnova™ H00051373P01.10ug

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifikationer

Accession Number AAH54031
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 51373
Molecular Weight (g/mol) 40.04
Name MRPS17 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias HSPC011/MRP-S17/RPMS17
Common Name MRPS17
Gene Symbol MRPS17
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.