missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MPND Antibody, Novus Biologicals™

MPND Antibody, Novus Biologicals™

Product Code. p-200039260 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Unit Size:
0.1mL
25µL
Product Code. Quantity unitSize
18454312 25ul 25µL
18171442 0.1 mL 0.1mL
2 options
This item is not returnable. View return policy

Product Code. 18454312

Brand: Novus Biologicals NBP23057125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MPND Polyclonal specifically detects MPND in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MPND
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8N594
Gene Alias EC 3.4, FLJ14981, MPN domain containing, MPN domain-containing protein
Gene Symbols MPND
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84954
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.