missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16109456

FKBP10, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16109456
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
Product Code. Quantity unitSize
16109456 50 μL 50µL
1 options
This item is not returnable. View return policy

Product Code. 16109456

Brand: Abnova H00060681A01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant FKBP10.

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq

Sequence: ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV

Specifications

Antigen FKBP10
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant FKBP10.
Formulation 50% glycerol
Gene FKBP10
Gene Accession No. NM_021939
Gene Alias FKBP6/FKBP65/FLJ20683/FLJ22041/FLJ23833/hFKBP65
Gene Symbols FKBP10
Host Species Mouse
Immunogen FKBP10 (NP_068758, 377 a.a. to 470 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60681
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.