missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MMP28 (Human) Recombinant Protein
Human MMP28 partial ORF ( NP_077278, 441 a.a. - 520 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00079148-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Specifications
| NP_077278 | |
| matrix metallopeptidase 28 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MMP28 | |
| GST |
| 79148 | |
| Wheat germ expression system | |
| 10 μg | |
| EPILYSIN, MM28, MMP-28, MMP25 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |