missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MICAL3 Antibody (3A6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00057553-M08
This item is not returnable.
View return policy
Description
MICAL3 Monoclonal antibody specifically detects MICAL3 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| MICAL3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| microtubule associated monoxygenase, calponin and LIM domain containing 3 | |
| MICAL3 (XP_032996.2, 251 a.a. ∽ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 3A6 | |
| Western Blot, ELISA, Sandwich ELISA | |
| XP_032996.2 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 57553 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction