missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MGMT (Human) Recombinant Protein

Product Code. 16111235
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Product Code. Quantity unitSize
16111235 10 μg 10µg
16121235 25 μg 25µg
2 options
This item is not returnable. View return policy

Product Code. 16111235

Brand: Abnova™ H00004255P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Human MGMT full-length ORF ( AAH00824, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Specifications

Accession Number AAH00824
Gene ID (Entrez) 4255
Name O-6-methylguanine-DNA methyltransferase
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 10 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol MGMT
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.