missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Product Code. 18725663 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
18725663 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 18725663

Brand: Novus Biologicals™ NBP187456PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSRA. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87456. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 4482
Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol MSRA
Label Type Unlabeled
Molecular Weight (g/mol) 25kDa
Product Type Methionine Sulfoxide Reductase A
Quantity 0.1 mL
Regulatory Status RUO
Immunogen ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.