missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18361230

Novus Biologicals™ Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Recombinant Protein Antigen

Product Code. 18361230 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
This item is not returnable. View return policy

Product Code. 18361230

Brand: Novus Biologicals™ NBP187855PEP

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KDM4A. The Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Recombinant Protein Antigen is derived from E. coli. The Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87855. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 9682
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol KDM4A
Label Type Unlabeled
Molecular Weight (g/mol) 31kDa
Product Type Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87855. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
Mehr anzeigen Weniger anzeigen

For Research Use Only

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt