missing translation for 'onlineSavingsMsg'
Learn More

LSM6 Antibody (4B5-1B10), Novus Biologicals™

Mouse Monoclonal Antibody

Marque: Novus Biologicals H00011157-M01

Code produit. 18329789

Please sign in to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

LSM6 Monoclonal antibody specifically detects LSM6 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Spécification

Antigen	LSM6
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), Sm protein F, U6 snRNA-associated Sm-like protein LSm6, YDR378C
Immunogen	LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
Quantity	0.1 mg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, ELISA, Immunocytochemistry
Clone	4B5-1B10
Dilution	Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Gene Accession No.	AAH16026
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Gene ID (Entrez)	11157
Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Isotype	IgG1 κ

Suggestions de produits

Description