missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM6 Antibody (4B5-1B10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00011157-M01
This item is not returnable.
View return policy
Description
LSM6 Monoclonal antibody specifically detects LSM6 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| LSM6 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), Sm protein F, U6 snRNA-associated Sm-like protein LSm6, YDR378C | |
| LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry | |
| 4B5-1B10 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| AAH16026 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 11157 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction