missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ LOC143241 Recombinant Protein

Código de producto. 16128303
Click to view available options
Quantity:
10 μg
25 μg
Tamaño de la unidad:
10µg
25µg
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16128303

Marca: Abnova™ H00143241P01.10ug

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Accession Number AAH19250
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 143241
Molecular Weight (g/mol) 45.6
Name LOC143241 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias DPY30D1/FLJ43920/bA36D19.5
Common Name DYDC1
Gene Symbol DYDC1
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado