missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KDM6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
2480.00 NOK - 5065.00 NOK
Specifications
| Antigen | KDM6A |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397)., Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18407920
|
Novus Biologicals
NBP1-80628-25ul |
25ul |
2480.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18738313
|
Novus Biologicals
NBP1-80628 |
5065.00 NOK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
KDM6A Polyclonal specifically detects KDM6A in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KDM6A | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| bA386N14.2, bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX)), DKFZp686A03225, EC 1.14.11, EC 1.14.11.-, Histone demethylase UTX, lysine (K)-specific demethylase 6A, MGC141941, ubiquitously transcribed tetratricopeptide repeat protein X-linked, ubiquitously transcribed tetratricopeptide repeat, X chromosome, ubiquitously transcribed TPR protein on the X chromosome, ubiquitously transcribed X chromosome tetratricopeptide repeat protein, ubiquitously-transcribed TPR gene on the X chromosome, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein, UTXlysine-specific demethylase 6A | |
| KDM6A | |
| IgG | |
| Affinity Purified | |
| Specificity of human KDM6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397)., Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7403 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title