missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Jagged 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-86337
This item is not returnable.
View return policy
Description
Jagged 2 Polyclonal specifically detects Jagged 2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Specifications
| Jagged 2 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| JAG2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS | |
| 0.1 mL | |
| Primary | |
| Specificity of human Jagged 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| 0.05mg/mL | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen | |
| HJ2, jagged 2, Jagged2, protein jagged-2, SER2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 3714 | |
| Human, Mouse, Hamster | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction