missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin alpha 2/CD49b Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
2755.00 NOK - 4520.00 NOK
Specifications
| Antigen | Integrin alpha 2/CD49b |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18606405
|
Novus Biologicals
NBP2-38995-25ul |
25 μL |
2755.00 NOK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18161679
|
Novus Biologicals
NBP2-38995 |
0.1 mL |
4520.00 NOK
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Integrin alpha 2/CD49b Polyclonal specifically detects Integrin alpha 2/CD49b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Integrin alpha 2/CD49b | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers, Innate Immunity, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2 | |
| ITGA2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P17301 | |
| 3673 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title