missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF254 Partial ORF (NP_004867.2, 149 a.a. - 209 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009534-Q02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140886

  • 4130.00 NOK / 10µg
Estimated Shipment: 06-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]

Sequence: AQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKS
Specifications

Specifications

NP_004867.2
Liquid
9534
ZNF254 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BMZF-5/FLJ58216/HD-ZNF1/ZNF539/ZNF91L
ZNF254
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.34kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKS
RUO
ZNF254
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers