missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196839

Invitrogen™ Human V-ATPase G1 (aa 42-115) Control Fragment Recombinant Protein

Codice prodotto. 30196839
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 30196839

Marca: Invitrogen™ RP104763

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65342 (PA5-65342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number O75348
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9550
Name Human V-ATPase G1 (aa 42-115) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810024D14Rik; AA960677; ATP6G; ATP6G1; ATP6GL; ATP6J; ATP6V1G1; ATPase H+ transporting V1 subunit G1; ATPase, H transporting, lysosomal V1 subunit G1; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J; ATPase, H+ transporting, lysosomal 13 kD, V1 subunit G; ATPase, H+ transporting, lysosomal 13 kDa, V1 subunit G1; ATPase, H+ transporting, lysosomal V1 subunit G1; ATPase, H+ transporting, V1 subunit G; DKFZp547P234; lysosomal 13 kDa; vacuolar ATP synthase subunit M16; vacuolar H(+)-ATPase subunit G 1; vacuolar proton pump subunit G 1; Vacuolar proton pump subunit M16; VAG1; V-ATPase 13 kDa subunit 1; V-ATPase subunit G 1; Vma10; V-type proton ATPase subunit G 1
Common Name V-ATPase G1
Gene Symbol ATP6V1G1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato