missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UROD Full-length ORF (AAH01778.1, 1 a.a. - 367 a.a.) Recombinant Protein MW: 66kDa with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007389-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16127345

  • 4115.00 NOK / 10µg
Estimated Shipment: 13-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria. [provided by RefSeq]

Sequence: MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Specifications

Specifications

AAH01778.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
66kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCT
UROD
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
7389
UROD (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
RUO
UROD
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers