missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UCRC Full-length ORF (AAH05402, 1 a.a. - 63 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00029796-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16189102

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM]

Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Specifications

Specifications

AAH05402
Liquid
29796
UCRC (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
RUO
UCRC
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.67kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSPC051/HSPC119/HSPC151
UCRC
Yes
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers