Learn More
Abnova™ Human UCP1 Partial ORF (NP_068605, 232 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007350-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]
Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFSpecifications
NP_068605 | |
Liquid | |
7350 | |
UCP1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SLC25A7/UCP | |
UCP1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
29.7kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF | |
RUO | |
UCP1 | |
Wheat Germ (in vitro) | |
GST |